Description
WRCH1 Polyclonal specifically detects WRCH1 in Human samples. It is validated for Western Blot.
Specifications
| Antigen | WRCH1 |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Formulation | PBS, 2% Sucrose with 0.09% Sodium Azide |
| Gene Alias | ARHU, CDC42L1GTP-binding protein-like 1, DJ646B12.2, fJ646B12.2, FLJ10616,2310026M05Rik, G28K, GTP-binding protein like 1, GTP-binding protein SB128, hG28K, ras homolog gene family, member U, ras-like gene family member U, Rho GTPase-like protein ARHU, rho-related GTP-binding protein RhoU, Ryu GTPase, Wnt-1 responsive Cdc42 homolog 1, WRCH-1, WRCH1CDC42-like GTPase 1 |
| Host Species | Rabbit |
| Purification Method | Affinity purified |
| Regulatory Status | RUO |
| Primary or Secondary | Primary |
| Test Specificity | Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Human: 100%; Rabbit: 100%; Chicken: 92%; Mouse: 92%; Guinea pig: 78%. |
| Target Species | Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit |
| Isotype | IgG |
| Applications | Western Blot |
| Concentration | 0.5 mg/ml |
| Dilution | Western Blot 1.0 ug/ml |
| Gene Accession No. | Q7L0Q8 |
| Gene Symbols | RHOU |
| Immunogen | Synthetic peptides corresponding to RHOU(ras homolog gene family, member U) The peptide sequence was selected from the C terminal of RHOU. Peptide sequence LKEVFDAAIVAGIQYSDTQQQPKKSKSRTPDKMKNLSKSWWKKYCCFV. |
| Quantity | 100 μL |
| Research Discipline | Cell Biology, Signal Transduction |
| Gene ID (Entrez) | 58480 |
| Reconstitution | Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. |
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Reviews
There are no reviews yet.