Previous
Previous Product Image

EIF2AK1 Rabbit anti-Human, Rat, Polyclonal, Novus Biologicals

$499.50
Next

CLS1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals

$499.50
Next Product Image

SELI Rabbit anti-Rat, Polyclonal, Novus Biologicals

$499.50

Unit: Each of 1

Description

SELI Polyclonal specifically detects SELI in Rat samples. It is validated for Western Blot.

Specifications

Antigen SELI
Classification Polyclonal
Dilution Western Blot 1.0 ug/ml
Gene Alias EC 2.7.8.1, ethanolaminephosphotransferase 1 (CDP-ethanolamine-specific), hEPT1, KIAA1724ethanolaminephosphotransferase 1, Selenoprotein I, SelI, SELIethanolaminephosphotransferase1, SEPI
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Seli (NP_001128226). Peptide sequence FMLLVFNFLLLTYFDPDFYASAPGHKHVPDWVWIVVGILNFVAYTLDGVD
Quantity 100 μg
Primary or Secondary Primary
Target Species Rat
Form Purified
Applications Western Blot
Conjugate Unconjugated
Formulation PBS buffer, 2% sucrose
Host Species Rabbit
Purification Method Affinity purified
Regulatory Status RUO
Gene ID (Entrez) 85465
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Shopping cart

1

Subtotal: $499.50

View cartCheckout