Description
SELI Polyclonal specifically detects SELI in Rat samples. It is validated for Western Blot.
Specifications
| Antigen | SELI |
| Classification | Polyclonal |
| Dilution | Western Blot 1.0 ug/ml |
| Gene Alias | EC 2.7.8.1, ethanolaminephosphotransferase 1 (CDP-ethanolamine-specific), hEPT1, KIAA1724ethanolaminephosphotransferase 1, Selenoprotein I, SelI, SELIethanolaminephosphotransferase1, SEPI |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Seli (NP_001128226). Peptide sequence FMLLVFNFLLLTYFDPDFYASAPGHKHVPDWVWIVVGILNFVAYTLDGVD |
| Quantity | 100 μg |
| Primary or Secondary | Primary |
| Target Species | Rat |
| Form | Purified |
| Applications | Western Blot |
| Conjugate | Unconjugated |
| Formulation | PBS buffer, 2% sucrose |
| Host Species | Rabbit |
| Purification Method | Affinity purified |
| Regulatory Status | RUO |
| Gene ID (Entrez) | 85465 |
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
