Description
Proenkephalin Polyclonal specifically detects Proenkephalin in Human samples. It is validated for Western Blot.
Specifications
| Antigen | Proenkephalin |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Formulation | PBS, 2% Sucrose with 0.09% Sodium Azide |
| Gene Alias | enkephalin A, preproenkephalin, proenkephalin, proenkephalin-A |
| Host Species | Rabbit |
| Purification Method | Affinity purified |
| Regulatory Status | RUO |
| Primary or Secondary | Primary |
| Test Specificity | Expected identity based on immunogen sequence: Human: 100%. |
| Target Species | Human |
| Isotype | IgG |
| Applications | Western Blot |
| Concentration | 0.5 mg/ml |
| Dilution | Western Blot 1.0 ug/ml |
| Gene Accession No. | P01210 |
| Gene Symbols | PENK |
| Immunogen | Synthetic peptides corresponding to PENK(proenkephalin) The peptide sequence was selected from the middle region of PENK. Peptide sequence DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRG. |
| Quantity | 100 μL |
| Research Discipline | Neuroscience |
| Gene ID (Entrez) | 5179 |
| Reconstitution | Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. |
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Reviews
There are no reviews yet.