Description
GRB 14 Polyclonal specifically detects GRB 14 in Rat samples. It is validated for Western Blot.
Specifications
| Antigen | GRB 14 |
| Classification | Polyclonal |
| Dilution | Western Blot 1.0 ug/ml |
| Gene Alias | GRB14 adapter protein, growth factor receptor-bound protein 14 |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Rat GRB 14 (NP_113811). Peptide sequence KAYFFLRRSGLYFSTKGTSKEPRHLQFFSEFSTSNVYMSLAGKKKHGAPT |
| Quantity | 100 μg |
| Primary or Secondary | Primary |
| Target Species | Rat |
| Form | Purified |
| Applications | Western Blot |
| Conjugate | Unconjugated |
| Formulation | PBS buffer, 2% sucrose |
| Host Species | Rabbit |
| Purification Method | Affinity purified |
| Regulatory Status | RUO |
| Gene ID (Entrez) | 2888 |
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
