Description
GluR2 Monoclonal antibody specifically detects GluR2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| Antigen | GluR2 |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Host Species | Rabbit |
| Purification Method | Affinity purified |
| Regulatory Status | RUO |
| Primary or Secondary | Primary |
| Target Species | Human, Mouse, Rat |
| Form | Purified |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Clone | 9R1X2 |
| Dilution | Western Blot 1:500 – 1:2000, Immunohistochemistry 1:50 – 1:200, Immunocytochemistry/Immunofluorescence 1:50 – 1:200, Immunohistochemistry-Paraffin 1:50 – 1:200 |
| Gene Alias | AMPA 2, glutamate receptor, ionotropic, AMPA 2 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human GluR2 (P42262). YLYDSDRGLSTLQAVLDSAAEKKWQVTAINVGNINNDKKDEMYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANLGFTDGDLLKI |
| Quantity | 100 μg |
| Research Discipline | Apoptosis, Cancer, GPCR, Neuronal Cell Markers, Neuroscience, Neurotransmission, Tumor Suppressors, Vision |
| Gene ID (Entrez) | 2891 |
| Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
| Isotype | IgG |
Reviews
There are no reviews yet.