Description
Description
The protein encoded by this gene interacts with calcineurin A and inhibits calcineurin-dependent signaling pathways, possibly affecting central nervous system development. This gene is located in the minimal candidate region for the Down syndrome phenotype, and is overexpressed in the brain of Down syndrome fetuses. Chronic overexpression of this gene may lead to neurofibrillary tangles such as those associated with Alzheimer disease. Three transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq
Sequence: MEEVDLQDLPSATIACHLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAADARLQLHKTEFLGKEMKLYFAQTLHIGSSHLAPPN
Specifications
| Antigen | DSCR1 |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Formulation | ascites with no preservative |
| Gene Accession No. | BC002864 |
| Gene Symbols | RCAN1 |
| Immunogen | DSCR1 (AAH02864, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Regulatory Status | RUO |
| Gene ID (Entrez) | 1827 |
| Content And Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Form | Ascites |
| Applications | ELISA, Western Blot |
| Clone | 1G7 |
| Description | Mouse monoclonal antibody raised against a partial recombinant DSCR1. |
| Gene | RCAN1 |
| Gene Alias | ADAPT78/CSP1/DSC1/DSCR1/MCIP1/RCN1 |
| Host Species | Mouse |
| Quantity | 200 μL |
| Primary or Secondary | Primary |
| Target Species | Human |
| Product Type | Antibody |
| Isotype | IgG1 κ |
Reviews
There are no reviews yet.