Description
DPYS Polyclonal specifically detects DPYS in Human samples. It is validated for Western Blot.
Specifications
| Antigen | DPYS |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Formulation | PBS, 2% Sucrose with 0.09% Sodium Azide |
| Gene Alias | DHPasehydantoinase, DHPHydantoinase, dihydropyrimidinase, Dihydropyrimidine amidohydrolase, EC 3.5.2.2 |
| Host Species | Rabbit |
| Molecular Weight of Antigen | 56 kDa |
| Quantity | 100 μL |
| Primary or Secondary | Primary |
| Reconstitution | Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. |
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Isotype | IgG |
| Applications | Western Blot |
| Concentration | 1 mg/ml |
| Dilution | Western Blot 1.0 ug/ml |
| Gene Accession No. | Q14117 |
| Gene Symbols | DPYS |
| Immunogen | Synthetic peptides corresponding to DPYS(dihydropyrimidinase) The peptide sequence was selected from the middle region of DPYS. Peptide sequence LRPDPSTPDFLMNLLANDDLTTTGTDNCTFNTCQKALGKDDFTKIPNGVN. |
| Purification Method | Protein A purified |
| Regulatory Status | RUO |
| Gene ID (Entrez) | 1807 |
| Target Species | Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish |
| Form | Purified |
Reviews
There are no reviews yet.