Description
Description
The protein encoded by this gene is an inflammatory chemokine that belongs to the CXC chemokine family. This chemokine is produced concomitantly with interleukin-8 (IL8) in response to stimulation with either interleukin-1 (IL1) or tumor necrosis factor-alpha (TNFA). This chemokine is a potent chemotaxin involved in neutrophil activation. [provided by RefSeq
Sequence: MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLRKVIQKILDGGNKEN
Specifications
| Antigen | CXCL5 |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Formulation | PBS with no preservative; pH 7.4 |
| Gene Accession No. | BC008376 |
| Gene Symbols | CXCL5 |
| Immunogen | CXCL5 (AAH08376, 1 a.a. ∼ 114 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Quantity | 50 μg |
| Primary or Secondary | Primary |
| Target Species | Human |
| Product Type | Antibody |
| Isotype | IgG1 κ |
| Applications | ELISA, Immunohistochemistry (PFA fixed), Western Blot |
| Clone | 2A9 |
| Description | Mouse monoclonal antibody raised against a full length recombinant CXCL5. |
| Gene | CXCL5 |
| Gene Alias | ENA-78/SCYB5 |
| Host Species | Mouse |
| Purification Method | Affinity chromatography |
| Regulatory Status | RUO |
| Gene ID (Entrez) | 6374 |
| Content And Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Form | Liquid |
Reviews
There are no reviews yet.