Description
CXCL4L1 Polyclonal specifically detects CXCL4L1 in Human samples. It is validated for Western Blot.
Specifications
| Antigen | CXCL4L1 |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Formulation | PBS, 2% Sucrose with 0.09% Sodium Azide |
| Gene Symbols | PF4V1 |
| Immunogen | Synthetic peptides corresponding to PF4V1(platelet factor 4 variant 1) The peptide sequence was selected from the middle region of PF4V1. Peptide sequence RPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLE. |
| Purification Method | Affinity purified |
| Regulatory Status | RUO |
| Primary or Secondary | Primary |
| Test Specificity | Porcine 85%. |
| Target Species | Human, Pig |
| Isotype | IgG |
| Applications | Western Blot |
| Concentration | 0.5 mg/ml |
| Dilution | Western Blot 1.0 ug/ml |
| Gene Alias | CXCL4V1, PF4A, PF4-ALT, platelet factor 4 variant, platelet factor 4 variant 1, variant 1 (PF4-like) |
| Host Species | Rabbit |
| Molecular Weight of Antigen | 11 kDa |
| Quantity | 100 μL |
| Research Discipline | Cytokine Research |
| Gene ID (Entrez) | 5197 |
| Reconstitution | Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. |
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Reviews
There are no reviews yet.