Description
ATP6V0D2 Polyclonal specifically detects ATP6V0D2 in Mouse samples. It is validated for Western Blot.
Specifications
| Antigen | ATP6V0D2 |
| Classification | Polyclonal |
| Dilution | Western Blot 1.0 ug/ml |
| Gene Alias | ATP6D2, ATP6V0, ATPase, H+ transporting, lysosomal 38kD, V0 subunit d isoform 2, ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d isoform 2, ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2, FLJ38708, Vacuolar proton pump subunit d 2, V-ATPase subunit d 2, VMA6, V-type proton ATPase subunit d 2 |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse ATP6V0D2 (NP_780615.2). Peptide sequence IITLNSFGTELSKEDRETLFPTCGRLYPEGLRLLAQAEDFEQMKRVADNY |
| Quantity | 100 μg |
| Primary or Secondary | Primary |
| Target Species | Mouse |
| Form | Purified |
| Applications | Western Blot |
| Conjugate | Unconjugated |
| Formulation | PBS buffer, 2% sucrose |
| Host Species | Rabbit |
| Purification Method | Affinity purified |
| Regulatory Status | RUO |
| Gene ID (Entrez) | 245972 |
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
