Description
Description
Apolipoprotein (apo)C4 gene is a member of the apolipoprotein gene family. It is expressed in the liver and has a predicted protein structure characteristic of the other genes in this family. Apo C4 is a 3.3kb gene consisting of 3 exons and 2 introns; it is located 0.5kb 5′ to the APOC2 gene. [provided by RefSeq]
Sequence: CQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG
Specifications
| Antigen | APOC4 |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Formulation | PBS with no preservative; pH 7.4 |
| Gene Accession No. | BC020723 |
| Host Species | Mouse |
| Purification Method | Affinity chromatography |
| Regulatory Status | RUO |
| Gene ID (Entrez) | 346 |
| Content And Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Form | Liquid |
| Applications | ELISA, Immunoprecipitation, Western Blot |
| Clone | 3D10 |
| Description | Mouse monoclonal antibody raised against a full length recombinant APOC4. |
| Gene | APOC4 |
| Gene Symbols | APOC4 |
| Immunogen | APOC4 (AAH20723.1, 27 a.a. ∼ 127 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Quantity | 100 μg |
| Primary or Secondary | Primary |
| Target Species | Human |
| Product Type | Antibody |
| Isotype | IgG2a κ |
Reviews
There are no reviews yet.