Description
17 beta-HSD14/HSD17B14 Polyclonal specifically detects 17 beta-HSD14/HSD17B14 in Human samples. It is validated for Western Blot.
Specifications
| Antigen | 17 beta-HSD14/HSD17B14 |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Formulation | PBS, 2% Sucrose with 0.09% Sodium Azide |
| Gene Alias | dehydrogenase/reductase (SDR family) member 10, Dehydrogenase/reductase SDR family member 10, DHRS1017-beta-hydroxysteroid dehydrogenase 14, EC 1.1.1.-, hydroxysteroid (17-beta) dehydrogenase 14,17-beta-hydroxysteroid dehydrogenase DHRS10, retinal short-chain dehydrogenase/reductase 3, Retinal short-chain dehydrogenase/reductase retSDR3, retSDR3, RETSDR3,17-beta-HSD 14, SDR3, SDR47C1, short chain dehydrogenase/reductase family 47C, member 1 |
| Host Species | Rabbit |
| Purification Method | Affinity purified |
| Regulatory Status | RUO |
| Primary or Secondary | Primary |
| Test Specificity | Expected identity based on immunogen sequence: Human: 100%;. |
| Target Species | Human |
| Isotype | IgG |
| Applications | Western Blot |
| Concentration | 0.5 mg/ml |
| Dilution | Western Blot 1.0 ug/ml |
| Gene Accession No. | Q9BPX1 |
| Gene Symbols | HSD17B14 |
| Immunogen | Synthetic peptides corresponding to HSD17B14(hydroxysteroid (17-beta) dehydrogenase 14) The peptide sequence was selected from the middle region of HSD17B14. Peptide sequence QPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIP. |
| Quantity | 100 μL |
| Research Discipline | Lipid and Metabolism |
| Gene ID (Entrez) | 51171 |
| Reconstitution | Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. |
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Reviews
There are no reviews yet.